Search .uk domain droptimes. Home | Short Domains
Search > 4 characters and include a dot.

Domain warwickshirecaravanningandcamping.co.uk is no longer in the droplist (The drop list only contains domains which are about to drop).
The domain name could have already dropped and maybe available for registration or for sale by the new owner.
See if the domain resolves: warwickshirecaravanningandcamping.co.uk. Whois info for warwickshirecaravanningandcamping.co.uk.